Web stats for Bth - bth.co.in
2.20 Rating by ClearWebStats
This website has a #10,579,080 rank in global traffic. It has a .co.in as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, bth.co.in is SAFE to browse.
Traffic Report of Bth
Daily Unique Visitors: | 45 |
Daily Pageviews: | 90 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | 10,579,080 |
Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is bth.co.in server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 2 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 8 |
Google Adsense: | Not Applicable | Google Analytics: | UA-36251023-1 |
Websites Hosted on Same IP (i.e. 162.241.148.33)
Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute
- shrivishwakarmasafetytraininginstitute.com
The Shine English Academy – DREAM | LEARN | SPEAK
- theshineenglishacademy.com
Urvashi International Packers and Movers|Movers and Packers Hyderabad
- urvashiinternationalpackers.com
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
- 247bestpillpharma.com
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Mon, 03 Jun 2019 02:32:28 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.4.45
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Mon, 03 Jun 2019 02:32:28 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5501
Content-Type: text/html; charset=utf-8
Date: Mon, 03 Jun 2019 02:32:28 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.4.45
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Mon, 03 Jun 2019 02:32:28 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5501
Content-Type: text/html; charset=utf-8
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
bth.co.in | A | 21599 |
IP:162.241.148.33 |
bth.co.in | NS | 21599 |
Target:ns4.netmakerindia.com |
bth.co.in | NS | 21599 |
Target:ns3.netmakerindia.com |
bth.co.in | NS | 21599 |
Target:ns1.netmakerindia.com |
bth.co.in | NS | 21599 |
Target:ns2.netmakerindia.com |
bth.co.in | SOA | 21599 |
MNAME:ns1.netmakerindia.com RNAME:info.balilabs.com Serial:2019041602 Refresh:7200 Retry:7200 Expire:172800 |
bth.co.in | MX | 21599 |
Target:aspmx.l.google.com |
bth.co.in | MX | 21599 |
Priority:5 Target:alt3.aspmx.l.google.com |
bth.co.in | MX | 21599 |
Priority:10 Target:alt1.aspmx.l.google.com |
bth.co.in | MX | 21599 |
Priority:5 Target:alt4.aspmx.l.google.com |
bth.co.in | MX | 21599 |
Priority:10 Target:alt2.aspmx.l.google.com |
bth.co.in | TXT | 21599 |
TXT:v=spf1 redirect=_spf.mailhostbox.com |
bth.co.in | TXT | 21599 |
TXT:google-site-verification=op2n5ywUCjuncwZ nE6DfrwPs-gwSeVjN7-FC7YrANdE |
Similarly Ranked Websites to Bth
Fenton Nissan of Blue Springs | Nissan Dealer | Blue Springs, Missouri
- fentonkc.com
Fenton Nissan of Blue Springs is a Nissan dealer in Blue Springs, Missouri offering New Nissan, used Nissan, Pre-owned Nissan Service and Parts in Blue Springs, Missouri. Our website has everything you need.
Xzeres
- skystreamenergy.com
Renewable energy where you need it: The world's leading supplier of small wind turbines & wind-solar hybrid systems for homes, businesses, industry, sailing & more.