2.20 Rating by ClearWebStats
This website has a #10,579,080 rank in global traffic. It has a .co.in as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, bth.co.in is SAFE to browse.
Get Custom Widget

Traffic Report of Bth

Daily Unique Visitors: 45
Daily Pageviews: 90

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 10,579,080
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View bth.co.in site advisor rating Not Applicable

Where is bth.co.in server located?

Hosted IP Address:

162.241.148.33 View other site hosted with bth.co.in

Hosted Country:

bth.co.in hosted country US bth.co.in hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View bth.co.in HTML resources

Homepage Links Analysis

Welcome To Bali Test House Private Limited - Home

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 2
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 8
Google Adsense: Not Applicable Google Analytics: UA-36251023-1

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

bth.co.in favicon - jenniferchemsales.com

View bth.co.in Pagerank   bth.co.in alexa rank Not Applicable   bth.co.in website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

bth.co.in favicon - shrivishwakarmasafetytraininginstitute.com

View bth.co.in Pagerank   bth.co.in alexa rank Not Applicable   bth.co.in website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

bth.co.in favicon - theshineenglishacademy.com

View bth.co.in Pagerank   bth.co.in alexa rank Not Applicable   bth.co.in website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

bth.co.in favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View bth.co.in Pagerank   bth.co.in alexa rank Not Applicable   bth.co.in website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

bth.co.in favicon - 247bestpillpharma.com

View bth.co.in Pagerank   bth.co.in alexa rank Not Applicable   bth.co.in website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 03 Jun 2019 02:32:28 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.4.45
Expires: Mon, 26 Jul 1997 05:00:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Upgrade: h2,h2c
Connection: Upgrade
Last-Modified: Mon, 03 Jun 2019 02:32:28 GMT
Accept-Ranges: none
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 5501
Content-Type: text/html; charset=utf-8

Domain Nameserver Information

Host IP Address Country
ns1.netmakerindia.com bth.co.in name server information 162.251.82.251 bth.co.in server is located in United States United States
ns4.netmakerindia.com bth.co.in name server information 162.251.82.252 bth.co.in server is located in United States United States
ns3.netmakerindia.com bth.co.in name server information 162.251.82.119 bth.co.in server is located in United States United States
ns2.netmakerindia.com bth.co.in name server information 162.251.82.248 bth.co.in server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
bth.co.in A 21599 IP:162.241.148.33
bth.co.in NS 21599 Target:ns4.netmakerindia.com
bth.co.in NS 21599 Target:ns3.netmakerindia.com
bth.co.in NS 21599 Target:ns1.netmakerindia.com
bth.co.in NS 21599 Target:ns2.netmakerindia.com
bth.co.in SOA 21599 MNAME:ns1.netmakerindia.com
RNAME:info.balilabs.com
Serial:2019041602
Refresh:7200
Retry:7200
Expire:172800
bth.co.in MX 21599 Target:aspmx.l.google.com
bth.co.in MX 21599 Priority:5
Target:alt3.aspmx.l.google.com
bth.co.in MX 21599 Priority:10
Target:alt1.aspmx.l.google.com
bth.co.in MX 21599 Priority:5
Target:alt4.aspmx.l.google.com
bth.co.in MX 21599 Priority:10
Target:alt2.aspmx.l.google.com
bth.co.in TXT 21599 TXT:v=spf1 redirect=_spf.mailhostbox.com
bth.co.in TXT 21599 TXT:google-site-verification=op2n5ywUCjuncwZ
nE6DfrwPs-gwSeVjN7-FC7YrANdE

Similarly Ranked Websites to Bth

El espacio docente de Adriana

bth.co.in favicon - impo-adriana.blogspot.com

Your Blog Description...

View bth.co.in Pagerank   Alexa rank for bth.co.in 10,579,084   website value of bth.co.in $ 8.95

Fenton Nissan of Blue Springs | Nissan Dealer | Blue Springs, Missouri

bth.co.in favicon - fentonkc.com

Fenton Nissan of Blue Springs is a Nissan dealer in Blue Springs, Missouri offering New Nissan, used Nissan, Pre-owned Nissan Service and Parts in Blue Springs, Missouri. Our website has everything you need.

View bth.co.in Pagerank   Alexa rank for bth.co.in 10,579,086   website value of bth.co.in $ 8.95


Golden Apple Products

bth.co.in favicon - goldenappleproducts.com

View bth.co.in Pagerank   Alexa rank for bth.co.in 10,579,100   website value of bth.co.in $ 8.95

Xzeres

bth.co.in favicon - skystreamenergy.com

Renewable energy where you need it: The world's leading supplier of small wind turbines & wind-solar hybrid systems for homes, businesses, industry, sailing & more.

View bth.co.in Pagerank   Alexa rank for bth.co.in 10,579,101   website value of bth.co.in $ 8.95